Anticaries compositions

by: Revis, George Joe;

The present invention relates to oral and edible compositions intended to provide an anticaries benefit. The primary active ingredient in these compositions is a protein selected from the group consisting of cystatin S, cystatin SA, cystatin SN and mixtures thereof which are salivary proteins. Also included are fragments of the proteins which may be used in place of the total proteins.

TECHNICAL FIELD

The present invention relates to oral and edible compositions containing certain salivary proteins or a fragment thereof to provide an anticaries effect.

BACKGROUND OF THE INVENTION

Dental caries is still a problem even though fluoridated water and fluoride toothpastes have reduced the incidence of caries to a very significant degree. There is interest, however, in developing products which possess the ability to reduce caries even more in the absence of fluoride or at a low fluoride ion concentration.

While there is an interest in developing and marketing products which reduce caries without reliance on a high level of fluoride ions, there have not been many reports of such approaches meeting with success. One approach reported is the use of phosphopeptides as disclosed in EPO 344,832 A1, Dec. 6, 1989 to Unilever.

The present inventors have surprisingly found that oral and edible compositions containing certain salivary proteins or a fragment thereof can reduce caries in those persons who have a tendency to develop caries.

While not wishing to be bound by theory, the anticaries efficacy of the cystatins is possibly due to their surprising ability to reduce acid production which acids contribute to caries.

It is thereof an object of the present invention to provide oral and edible compositions which contain cystatin S or cystatin SA or cystatin SN or a mixture thereof or a fragment thereof.

It is also an object of this invention to provide methods of reducing caries through the use of such compositions.

These and other objects will become more apparent from the detailed description which follows.

All percentages and ratios used herein are by weight unless otherwise indicates. Additionally, all measurements are made at 25.degree. C. unless otherwise indicated.

SUMMARY OF THE INVENTION

The compositions of the present invention comprise an effective amount of cystatin S, cystatin SA, cystatin SN or a mixture thereof or a fragment thereof in a suitable oral or edible carrier.

The present invention further comprises the use of an effective amount of the compositions described herein to combat caries.

DETAILED DESCRIPTION OF THE INVENTION

By "oral compositions" as used herein means a product which in the ordinary course of usage is not intentionally swallowed for purposes of systemic administration of particular therapeutic agents, but is rather retained in the oral cavity for a time sufficient to contact substantially all of the dental surfaces and/or oral tissues for purposes of oral activity.

By "edible" composition as used herein is meant a composition which in the ordinary course of usage is intentionally swallowed.

By "safe and effective amount" as used herein means sufficient amount of material to provide the desired benefit while being safe to the hard and soft tissues of the oral cavity.

By the term "comprising", as used herein, is meant that various additional components can be conjointly employed in the compositions of this invention as long as the listed materials perform their intended functions.

By the term "carrier" as used herein, is meant a suitable vehicle which can be used to apply the present composition in the oral cavity and either ingested or expectorated after use.

Cystatin S, Cystatin SA or Cystatin SN

Cystatin S is 121 residues in length with an MW=14,190. The gene responsible for the synthesis of cystatin S has three exons, I, II and III, which encode the following three amino acid sequences:

Exon I=SSSKEENRIIPGGIYDADLNDEWVQRALHF

AISEYNKATEDEYYRRPLQVLRAREQ

Exon II=TFGGVNYFFDVEVGRTICTKSQPN

LDTCAFHEQPELQK

Exon III=KQLCSFEIYYEVPWEDRMSLVDSRCQEA

Cystatin SA is also 121 residues in length with a MW=14,347. The gene responsible for the synthesis of cystatin SA also has three exons, I, II, and III, which encode the following three amino acid sequences:

Exon I=WSPQEEDRIIEGGIYDADLNDERVQRALH

FVISEYNKATEDEYYRRLLRVLRAREQ

Exon II=IVGGVNYFFDIEVGRTICT

KSQPNLDTCAFHEQPELQK

Exon III=KQLCSFQIYEVPWEDRMSLVNSRCQEA

Cystatin SN is 121 residues in length with a MW=14,311. The gene responsible for the synthesis of cystatin SN has three exons, I, II, and III, which correspond to the following three sequences:

Exon I=WSPKEEDRIIPGGIYNADLNDEWVQRALHFAJSEYNKAT

KDDYYRRPLRVLRARQQ

Exon II=TVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQK

Exon III=KQLCSFEIYEVPWENRRSLVKSRCQES

W=Trp,S=Ser, P=Pro,K=Lys,E=Glu,D=Asp,R=Arg,I=Ile,G=Gly,Y=Tyr, N=Asn,A=Ala, Q=Gla,T=Thr,V=Val,C=Cys,L=Leu,H=His,F=Phe

The "cystatin fragment" as that term is used herein includes any linear, cyclic or blocked polypeptide fragment greater than or equal to three residues in length or any modified polypeptide fragments of cystatin S, SA or SN having at least 75% homology to the original cystatin fragment. Examples of said fragments are:

A=WSPKEEDRII

B=KATKDDYYRRPLRVLRARQQ

C=ALHIFAISEYNKATKDDYYRRPLRVLRARQQ

D=ADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQ

Examples of modified cystatin fragments with the modification in brackets are:

E=WSP›R!

F=SSSKEE›R!RI›E!

The cystatins or a fragment thereof are used in the present compositions at any effective level. The levels are generally in the range of about 0.001% to about 5%, preferably from about 0.005% to about 1%, most preferably from about 0.01% to about 0.5%.

Acceptable Carrier

A preferred carrier composition for the active(s) of this invention are oral compositions. Such compositions include toothpastes, mouthrinses, liquid dentifrices, lozenges, chewing gums or other vehicle suitable for use in the oral cavity. Toothpastes and mouthrinses are the preferred systems.

The abrasive polishing material contemplated for use in the toothpaste compositions of the present invention can be any material which does not excessively abrade dentin. These include, for example, silicas including gels and precipitates, calcium carbonate, dicalcium orthophosphate dihydrate, calcium pyrophosphate, tricalcium phosphate, calcium polymetaphosphate, insoluble sodium polymetaphosphate, hydrated alumina, and resinous abrasive materials such as particulate condensation products of urea and formaldehyde, and others such as disclosed by Cooley et al. in U.S. Pat. No. 3,070,510, Dec. 25, 1962, incorporated herein by reference. Mixtures of abrasives may also be used.

Silica dental abrasives, of various types, can provide the unique benefits of exceptional dental cleaning and polishing performance without unduly abrading tooth enamel or dentin. For these reasons, they are preferred for use herein.

The silica abrasive polishing materials useful herein, as well as the other abrasives, generally have an average particle size ranging between about 0.1 and 30 microns, preferably 5 and 15 microns. The silica abrasive can be precipitated silica or silica gels such as the silica xerogels described in Pader et al., U.S. Pat. No. 3,538,230, issued Mar. 2, 1970 and DiGiulio, U.S. Pat. No. 3,862,307, Jun. 21, 1975, both incorporated herein by reference. Preferred are the silica xerogels marketed under the tradename "Syloid" by W. R. Grace & Company, Davison Chemical Division. Preferred precipitated silica materials include those marketed by the J. M. Huber Corporation under the tradename, "Zeodent", particularly the silica carrying the designation "Zeodent 119". These silica abrasives are described in U.S. Pat. No. 4,340,583, Jul. 29, 1982, incorporated herein by reference.

The abrasive in the toothpaste compositions described herein is present at a level of from about 6% to 70%, preferably from about 15% to about 25%.

Flavoring agents can also be added to toothpaste compositions. Suitable flavoring agents include oil of wintergreen, oil of peppermint, oil of spearmint, oil of sassafras, and oil of clove. Sweetening agents which can be used include aspartame, acesulfame, saccharin, dextrose, levulose and sodium cyclamate. Flavoring and sweetening agents are generally used in toothpastes at levels of from about 0.005% to about 2% by weight.

Toothpaste compositions can also contain emulsifying agents. Suitable emulsifying agents are those which are reasonably stable and foam throughout a wide pH range, including non-soap anionic, nonionic, cationic, zwittefionic and amphoteric organic synthetic surfactants. The preferred surfactants are those which are not anionic due to possible complexation of the cystatins which are zwitterionic with the surfactant. Many of these suitable agents are disclosed by Gieske et al. in U.S. Pat. No. 4,051,234, Sep. 27, 1977, incorporated herein by reference. The emulsifying agents are present at a level of from about 0.5% to about 2.0%.

Water is also present in the toothpastes of this invention. Water employed in the preparation of commercially suitable toothpastes should preferably be deionized and free of organic impurities. Water generally comprises from about 10% to 50%, preferably from about 30% to 50%, by weight of the toothpaste compositions herein. Thesee amounts of water include the free water which is added plus that which is introduced with other materials such as with sorbitol.

In preparing toothpastes, it is necessary to add some thickening material to provide a desirable consistency. Preferred thickening agents are carboxyvinyl polymers, carrageenan, hydroxyethyl cellulose and water soluble salts of cellulose ethers such as sodium carboxymethyl cellulose and sodium carboxymethyl hydroxyethyl cellulose. Natural gums such as gum karaya, xanthan gum, gum arabic, and gum tragacanth can also be used. Colloidal magnesium aluminum silicate or finely divided silica can be used as part of the thickening agent to further improve texture. Thickening agents in ane amount from 0.2% to 5.0% by weight of the total composition can be used.

It is also desirable to include some humectant material in a toothpaste to keep it from hardening. Suitable humectants include glycerin, sorbitol, and other edible polyhydric alcohols at a level of from about 15% to about 70%.

Another preferred embodiment of the present invention is a mouthwash composition. Conventional mouthwash composition components can comprise the carrier for the agents of the present invention. Mouthwashes generally comprise from about 20:1 to about 2:1 of a water/ethyl alcohol solution or be alcohol free and preferably other ingredients such as flavor, sweeteners, humectants and sudsing agents such as those mentioned above for dentifrices. The humectants, such as glycerin and sorbitol give a moist feel to the mouth. Generally, on a weight basis the mouthwashes of the invention comprise 0% to 60% (preferably 5% to 20%) ethyl alcohol, 0% to 20% (preferably 5% to 20%) of a humectant, 0% to 2% (preferably 0.01% to 1.0%) emulsifying agents, 0% to 0.5% (preferably 0.005% to 0.06%) sweetening agent such as saccharin or natural sweeteners such as stevroside 0% to 0.3% (preferably 0.03% to 0.3%) flavoring agent, and the balance water. Other optional components described herein earlier for use in toothpaste products are also useful in the mouthwash compositions.

An additional optional ingredient for use in the compositions is a soluble fluoride ion source. Such sources include sodium fluoride, stannous fluoride, sodium monofluorophosphate and are used in amounts sufficient to provide from about 10 to about 3500 ppm F-.

Still other optional ingredients include soluble pyrophosphate or phosphonates or carboxy polymers such as polyacrylic acid and methyl vinyl ether maleic anhydride as anticalculus agents. Also useful are antiplaque/gingivitis actives such as cationic materials such as chlorhexidine and cetyl pyridinium chloride, agents such as cimetidine and nonionic materials such as triclosan or triclosan monophosphate. These agents are described in the following U.S. Patents which are incorporated herein in then entirety: U.S. Pat. No. 4,515,772, May 7, 1985; U.S. Pat. No. 4,627,977, Dec. 9, 1986; and U.S. Pat. No. 5,032,386, Jul. 16, 1991.

The pH of the present compositions and/or the pH in the mouth can be any pH which is safe for the mouth's hard and soft tissues. Such pH's are generally from about 3 to about 10, preferably from about 4 to about 8.

Other acceptable oral carders include gums, lozenges, as well as other forms. Such suitable forms are disclosed in U.S. Pat. No. 4,083,955, Apr. 11, 1978 to Grabenstetter et al. incorporated herein in its entirety by reference.









Edible compositions are also suitable for use as the carrier compositions herein. Edible compositions include many types of solid as well as liquid compositions. Such compositions include, for example, soft drinks, citrus drinks, cookies, cakes, breads among many others. Such compositions may contain sugar or another sweetener, water, flour, shortening, other fibers such as wheat, corn, barley, rye, oats, psyllium and mixtures thereof.

METHOD OF MANUFACTURE

The method of obtaining the cystatins or a fragment thereof as well as manufacturing the final compositions as is set forth below.

PREPARATION OF CYSTATIN SN, S & SA

Fresh human submandibular/sublingual saliva from caries-resistant individuals is collected on ice, 0.degree. C. The collected saliva is made up to 50 mM Tris-HCl pH 7.5+0.1M NaCl and stirred on ice (0.degree. C.) for 2 hours. The samples are centrifuged at 100,000.times.g for 20-24 hours at 4.degree. C. to remove the mucins. The resultant supernatant is dialyzed extensively against H.sub.2 O at 7.degree. C. prior to ammonium sulfate fractionation. The 0-30% ammonium sulfate precipitate is discarded and the 30-50% ammonium sulfate precipitate is pelleted by centrifugation at 10,000.times.g for 15-20 minutes. The resultant pellet is extensively dialyzed against H.sub.2 O at 7.degree. C. The dissolved pellet is lyophilized and taken up in 50 mM MES pH 6.0 and injected onto a BioRad Macro-Prep High S Cation Exchange Support column (1 cm.times.21 cm) at a flow rate of 0.5 ml/min. The column effluent is monitored at 280 mn and the column is washed with 50 mM MES pH 6.0 until the protein coming through in the wash is eluted and the baseline has returned to normal. A gradient of 0 to 0.5M NaCl in 50 mM MES pH 6.0 at a flow rate of 1 ml/min for 30 minutes is used to elute the proteins from the colum. The individual fractions coming off the column are dialyzed extensively against H.sub.2 O at 7.degree. C. and lyophilized prior to further purification.

The combined S column wash fractions contain cystatin S+SA with only minor contamination by amylase according to the SDS-PAGE gel staining pattern and overall purity is further verified by HPLC reversed-phase chromatography.

Since the S column gradient fractions containing SN also contain significant amounts of the proline-rich proteins, cystatin SN is further purified using a batch hydroxyapatite procedure. BDH hydroxyapatite is hydrated in 25 mM Tris-HCl pH 8.0 0.1 mM NaH.sub.2 PO.sub.4 overnight and extensively defined. The lyophilized S column gradient fraction(s) containing SN is taken up in 25 mM Tris-HCl pH 8.0+0.1 mM NaH.sub.2 PO.sub.4 and added to the hydroxyapatite. This mixture is gently rocked at room temperature for 30 minutes, then centrifuged at 200.times.g for 10 minutes. The supernatant containing cystatin SN is removed and the hydroxyapatite is washed two more times with buffer and removed and combined with the first. The cystatin SN containing hydroxyapatite wash is dialyzed extensively against H.sub.2 O at 7.degree. C. and lyophilized.

Verification of the purification process is done by separation of aliquots of the column fractions using the Laemmeli SDS-PAGE gel electrophoresis. The gels are stained with 0.04% Commassie Blue R-250 and destained in 10% acetic acid to insure detection of the basic proline-rich proteins. Reversed-phase column chromatography is also used for further verification of purity. Lyophilized aliquots of the samples are dissolved in 5% Buffer B and 6 .mu.g is injected onto a Vydac 218TP54 reversed-phase column. (Buffer A=0.1% trifluoroacetic acid in H.sub.2 O; Buffer B=0.08% trifluoroacetic acid in 80% acetonitrile). A linear gradient of 5% to 100% B is run at a flow rate of 1.0 ml/min over 30 minutes. The absorption profile is followed at 214 nm.

PREPARATION OF WSPKEEDRII

The above peptide was synthesized using FastMoc chemistry (Fmoc protection, HBTU/HOBt activation) on an Applied Biosystems model 430A peptide synthesizer. HMP resin (0.29 g, 0.85 m mol/g) was used in the preparation of the above peptide along with 1 m mol of each amino acid. The cycles on the synthesizer were the standard FastMoc/NMP cycles.

After the synthesis the peptide was cleaved from the resin using TFA:EDT:H.sub.2 O:Phenol:Thioanisole ›10:0.25:0.5:0.75:0.5! for 1.5 hours at room temperature. The peptide-resin TFA mixture was filtered through a medium porosity filter and the filtrate reduced to 2 mL by rotary evaporation. This was diluted to 20 mL with H.sub.2 O and washed three times with an equal volume of Et.sub.2 O. The aqueous layer was lyophilized overnight.

The crude peptide was analyzed by reversed phase high performance chromatography (Beckman) on a Vydac column (C.sub.18 5 m 300A, 4.6.times.250 mm) with the following gradient 0-40% B over 40 minutes (A=0.1TFA, B=99.9% CH.sub.3 CN, 0.1% TFA) at 1 ml per minute. After characterization (see below) the crude peptide was prepped on a Vydac column (C.sub.18 10 m 300A, 25.times.250 mm) with the above gradient at a flow of 10 ml per minute.

Both the crude and HPLC purified peptide were characterized by LCMS techniques on a SCIEX MS, the appropriate mass was determined in both cases. The resulting peptide is >95% pure by HPLC.

Definitions

Fmoc, 9-Fluorenylmethyloxycarbonyl; HBTU, (2-(H-Benzotraizol-1-yl)-1, 1, 3, 3-tetramethyluronium hexafluorophosphate; HOBt, 1-Hydroxybenzotriazole; hydrate; HMP, p-Hydroxymethylphenoxymethyl polystyrene; NMP, N-Methylpyrrolidone; TFA, Trifluoroacetic acid; EDT, 1,2-Ethanedithiol.

Industrial Applicability

The compositions of the present invention are used in a conventional manner.

The following examples further describe and demonstrate preferred embodiments within the scope of the present invention. The examples are given solely for the purpose of illustration and are not to be construed as limitations of this invention. Many variations are possible without departing from the invention's spirit and scope.

In addition to the levels and combinations of ingredients shown in these examples, others can be used which are consistent with the invention as disclosed herein.

EXAMPLE I

This is a mouthrinse which is representative of the present invention.

    ______________________________________
    Component               Wt. %
    ______________________________________
    Cystatin SA             0.05
    Ethanol (190 proof)     5.500
    Glycerine               5.000
    Flavor                  0.070
    POE(20) Sorbitan Monoisostearate
                            0.050
    Sodium Saccharin        0.050
    Distilled Water         qs 100.000
    ______________________________________


EXAMPLE II

The following is a toothpaste which is representative of the present invention.

    ______________________________________
    Component            Wt. %
    ______________________________________
    Precipitated Silica Abrasive
                         35.0
    Cystatin SN          0.25
    Glycerin             5.0
    Sorbitol Solution (70%)
                         20.0
    Carboxymethyl Cellulose (0.7 D.S.)
                         0.5
    Monosodium Orthophosphate
                         0.3
    Monohydrate
    (NaH.sub.2 PO.sub.4 H.sub.2 O)
    Disodium Orthophosphate Dihydrate
                         0.3
    (Na.sub.2 HPO.sub.4 2H.sub.2 O)
    Nonionic Surfactant  2.3
    Flavor               0.9
    Sodium Saccharin     0.2
    Titanium Dioxide (TiO.sub.2)
                         0.5
    Speckles             0.5
    Distilled Water      q.s.
    Total                100.0
    ______________________________________


EXAMPLE III

This is another mouthrinse representative of the present invention.

    ______________________________________
    Component               Wt. %
    ______________________________________
    Fragment A*             0.500
    Ethanol (190 proof)     5.500
    Glyccrine               5.000
    Flavor                  0.070
    POE(20) Sorbitan Monoisostearate
                            0.050
    Sodium Saccharin        0.050
    Distilled Water         qs 100.000
    ______________________________________
     *Fragment A as defined on page 6, is WSPKEEDRII.


The proteins of Examples I and III were evaluated in a microbiological assay to determine their ability to reduce acid production.

In this assay, 200 ul of bacteria were suspended in saline with an optical density (O.D.) of 0.175, and were added to 200 ul of saline containing the protein (or polypeptide) and rambled for six minutes at 81/2 cycles/minute at 37.degree. C. Then 300 ul of a solution containing 11.2% sucrose, 0.9% saline and 0.21% trypticase soy broth without dextrose was added to the bacteria and the air-tight robes rambled for 2.5-4 hours when the pH was read using a micro-pH electrode.

The table below gives the concentration of the actives at which a 50% inhibition of acid production occurs relative to a negative control.

Concentration which gives a 50% reduction in acid production:

    ______________________________________
    Cystatin SA          6 .times. 10-7 M
    Fragment A           1 .times. 10-5 M
    ______________________________________


__________________________________________________________________________ SEQUENCE LISTING (1) GENERAL INFORMATION: (iii) NUMBER OF SEQUENCES: 9 (2) INFORMATION FOR SEQ ID NO:1: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 56 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: unknown (D) TOPOLOGY: unknown (xi) SEQUENCE DESCRIPTION: SEQ ID NO:1: SerSerSerLysGluGluAsnArgIleIleProGlyGlyIleTyrAsp 151015 AlaAspLeuAsnAspGluTrpValGlnArgAlaLeuHisPheAlaIle 202530 SerGluTyrAsnLysAlaThrGluAspGluTyrTyrArgArgProLeu 354045 GlnValLeuArgAlaArgGluGln 5055 (2) INFORMATION FOR SEQ ID NO:2: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 38 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: unknown (D) TOPOLOGY: unknown (xi) SEQUENCE DESCRIPTION: SEQ ID NO:2: ThrPheGlyGlyValAsnTyrPhePheAspValGluValGlyArgThr 151015 IleCysThrLysSerGlnProAsnLeuAspThrCysAlaPheHisGlu 202530 GlnProGluLeuGlnLys 35 (2) INFORMATION FOR SEQ ID NO:3: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 28 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: unknown (D) TOPOLOGY: unknown (xi) SEQUENCE DESCRIPTION: SEQ ID NO:3: LysGlnLeuCysSerPheGluIleTyrTyrGluValProTrpGluAsp 151015 ArgMetSerLeuValAspSerArgCysGlnGluAla 2025 (2) INFORMATION FOR SEQ ID NO:4: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 56 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: unknown (D) TOPOLOGY: unknown (xi) SEQUENCE DESCRIPTION: SEQ ID NO:4: TrpSerProGlnGluGluAspArgIleIleGluGlyGlyIleTyrAsp 151015 AlaAspLeuAsnAspGluArgValGlnArgAlaLeuHisPheValIle 202530 SerGluTyrAsnLysAlaThrGluAspGluTyrTyrArgArgLeuLeu 354045 ArgValLeuArgAlaArgGluGln 5055 (2) INFORMATION FOR SEQ ID NO:5: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 38 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: unknown (D) TOPOLOGY: unknown (xi) SEQUENCE DESCRIPTION: SEQ ID NO:5: IleValGlyGlyValAsnTyrPhePheAspIleGluValGlyArgThr 151015 IleCysThrLysSerGlnProAsnLeuAspThrCysAlaPheHisGlu 202530 GlnProGluLeuGlnLys 35 (2) INFORMATION FOR SEQ ID NO:6: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 27 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: unknown (D) TOPOLOGY: unknown (xi) SEQUENCE DESCRIPTION: SEQ ID NO:6: LysGlnLeuCysSerPheGlnIleTyrGluValProTrpGluAspArg 151015 MetSerLeuValAsnSerArgCysGlnGluAla 2025 (2) INFORMATION FOR SEQ ID NO:7: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 56 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: unknown (D) TOPOLOGY: unknown (xi) SEQUENCE DESCRIPTION: SEQ ID NO:7: TrpSerProLysGluGluAspArgIleIleProGlyGlyIleTyrAsn 151015 AlaAspLeuAsnAspGluTrpValGlnArgAlaLeuHisPheAlaIle 202530 SerGluTyrAsnLysAlaThrLysAspAspTyrTyrArgArgProLeu 354045 ArgValLeuArgAlaArgGlnGln 5055 (2) INFORMATION FOR SEQ ID NO:8: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 38 amino acids (B) TYPE: amino acid (D) TOPOLOGY: unknown (xi) SEQUENCE DESCRIPTION: SEQ ID NO:8: ThrValGlyGlyValAsnTyrPhePheAspValGluValGlyArgThr 151015 IleCysThrLysSerGlnProAsnLeuAspThrCysAlaPheHisGlu 202530 GlnProGluLeuGlnLys 35 (2) INFORMATION FOR SEQ ID NO:9: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 27 amino acids (B) TYPE: amino acid (D) TOPOLOGY: unknown (xi) SEQUENCE DESCRIPTION: SEQ ID NO:9: LysGlnLeuCysSerPheGluIleTyrGluValProTrpGluAsnArg 151015 ArgSerLeuValLysSerArgCysGlnGluSer 2025 __________________________________________________________________________

Asymmetric wire rope isolator

Unitary key holder

Solar thermal propulsion unit

Window sash

Three dimensional space viewing device

Pest bait station

Glass compositions

Clear impact-resistant syndiotactic polypropylene

High temperature diesel deposit tester

Railcar straddle for material handling

Magnetic blanket for horses

Output regulator

Flash jet coolant circulation system

Movement detector

Clothes hanger

Incontinence electrode apparatus

Automatic reversal mechanism

Master cylinder apparatus

Polysaccharides and preparation thereof

Elongated flexible detonating device

Fermentation process

Structurally efficient inflatable protective device

Intraocular lens

Aqueous coating composition

Impact-resisting composites

Motor vehicle wiper

Display hook system

Froth flotation

Terminal grounding unit

Somatostatin receptors

Catalyst patterning for nanowire devices

Surface modifier composition

Reversible code compander

Electrical coupling unit for electrosurgery

Hollow fiber separatory device

Dual-wavelength x-ray monochromator

Environmentally stable monolithic Mach-Zehnder device

Tricyclic amides

Fuel system

Thread wound golf ball

Fishing hooking device

Insulating insert for magnetic valves

Arrangement for moving an object

Mower deck bumper

Compartmentalized basket truck

Preparation of star polymers

Thin floss brush

Moisture-curing polyamides

Power converter device

Drain-extended MOS ESD protection structure

Sod cutter

Hard surface detergent composition

Stacker bundler shuttle system

Process for concentrating fluids

Ion-channel forming peptides

Lock for sliding doors

Plain bearing

Compact and robust spectrograph

Sulfonium salt compounds

Liquid container

Valve timing adjusting device

Multi-channel optical transmission system

Motor vehicle gearbox

Optical device, system and method

Dispenser

Ice body delivery apparatus

Water filtration assembly

Nitrogen detection

Imidazodiazepine derivative

Fuel dispensing nozzle

Towable "V" rake agricultural machine

Signal amplifier

Pharmaceutically active morpholinol

Powder dividing device for camera

Laterally supported flexible sign

Catalyzed fluorination of chlorocarbons

Magnetic domain propagation register

Motor control system

Medical garment

Automated nut-cracking apparatus and method

Neck towel and adjustable clasp

Method for purifying acetone

Probing with backside emission microscopy

Triarylpropyl-azabicyclooctanes

Internal combustion engine

Photographic film and film cassette

Depth-resolved fluorescence instrument

Manual floor sweeper

Preparation of 2-amino-4-fluoropyrimidine derivatives

1-(2-Aryl-4,5-disubstituted-1,3-dioxolan-2-ylmethyl)-1H-imidazoles and 1H-1,2,4-triazoles

Variable delivery compressor

Decoupled integrated circuit package

Tissue anchoring system and method

Optical fiber strain relief device

Shot gun shell tracer wad

Method for preparing microemulsions

Digital phase comparison apparatus

Variable delay memory system

Screw

Thin layer ablation apparatus

Light distribution device

Inter-LAN connection method using ISDN

Developing unit for electro-photographic apparatus

Splash guard

4-Aminoaliphatic-2,3,5,6-[dibenzobicyclo[5.1.0]octanes] and salts thereof

Control means for ground hydrants